PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004497135.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 243aa    MW: 27314.2 Da    PI: 6.6098
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004497135.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.65.9e-082366344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT + d+l+ +a    + +   +W++Ia+ ++ g+++ ++++++
   XP_004497135.1 23 QWTRDHDKLFERALLIVPEDlpdRWEKIAEQVP-GKSAAEVRDHY 66
                     6*****************99*************.**********9 PP

2Myb_DNA-binding43.95.3e-14126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_004497135.1 126 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 170
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.1031973IPR017884SANT domain
SMARTSM007171.3E-52072IPR001005SANT/Myb domain
SuperFamilySSF466892.09E-112278IPR009057Homeodomain-like
PfamPF002496.1E-72367IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-52370IPR009057Homeodomain-like
CDDcd001671.92E-62470No hitNo description
PROSITE profilePS5129420.947119175IPR017930Myb domain
SuperFamilySSF466895.11E-17121176IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-17122174IPR006447Myb domain, plants
SMARTSM007177.3E-11123173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-11123169IPR009057Homeodomain-like
PfamPF002496.7E-12126170IPR001005SANT/Myb domain
CDDcd001673.44E-9126171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MFRDTLAMAA AAATTRWPNQ PSQWTRDHDK LFERALLIVP EDLPDRWEKI AEQVPGKSAA  60
EVRDHYEALV HDVLEIDSGR VEVPSYSDDS AASGGGGGLS DWDSSNQISF GSKSRHGDNE  120
RKKGTPWTEE EHRLFLIGLS KFGKGDWRSI SRNVVVTRTP TQVASHAQKY FLRQNSVKKE  180
RKRSSIHDIT SVDSNSAPMP IDQNWVPPPG GSIQQSQEMH NYPSNNLQDH MGTFGYSNYG  240
FQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-151386273RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2350081e-128AC235008.3 Medicago truncatula clone mth2-151p16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004497135.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-60DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLG7ZYT01e-153G7ZYT0_MEDTR; DnaJ homolog subfamily C member
STRINGGLYMA20G24600.11e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-82MYB family protein